PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00211.1_g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 492aa    MW: 54585.5 Da    PI: 8.9081
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00211.1_g00040.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-10347394552
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                              kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l
  Rsa1.0_00211.1_g00040.1 347 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLL 394
                              899**************************************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-14343412IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795345395IPR004827Basic-leucine zipper domain
PfamPF001704.0E-9347394IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.85E-10347395No hitNo description
Gene3DG3DSA:1.20.5.1706.1E-11347395No hitNo description
CDDcd147039.13E-23348395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MGDTETDMIH RHHSSFGTSP SSIPKQKQKQ KQKLEINPNV IRSSESGKRV GVPPTSPYSQ  60
IHTSSSHSRS MSQPSSFFSL DSSLPPLSPS PFLRDHDLLL LSIHDDNKDS RPFSNNHNNP  120
SSLFPPSPFT TTTSETLPPR KSHRRSNSDI PTAFTSFPPR PTLERSVSGG ESSPFVKKED  180
REAMDDLFSA YMNLDNIDAF NSSDNLSRDD MESSRASGNK TNGGSDTEGE SSSVNYESGG  240
DHNHNHNHNN LKRRAADIAP PPPTTRHYRS VSVDSCFMDK LSFAQDSLKP PPSPMSRKVS  300
PTNSVDGGAA AAAFSMGEFK KGEFSAAEIK KIMANDKLAE MALSDPKRVK RILANRQSAA  360
RSKERKMRYI VELEHKVQTL QTEATTLSAQ LTLLQLIDPQ RDMMGLTNQN NELKFRLQAM  420
EQQARLRDAL NEALNGEVQR LKLAIGESES DRSKMQSLNA DMFQQLNISQ SRQQQPHHQN  480
GGTVSTKPES NE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411679.10.0hypothetical protein EUTSA_v10024895mg
TrEMBLV4MD770.0V4MD77_EUTSA; Uncharacterized protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
STRINGBra033582.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-146bZIP family protein